Monoclonal Anti-ADAMTS17 antibody produced in mouse

NA.41

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined. (provided by RefSeq)

ADAMTS17 (NP_620688, 543 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD

ADAM metallopeptidase with thrombospondin type 1 motif 17 (ADAMTS17) is associated with Weill-Marchesani-like syndrome. Knockdown of the protein has been shown to prevent the growth of breast cancer cells in vitro. ADAMTS17 binds to the extracellular matrix.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

3B7, monoclonal

buffered aqueous solution

mouse, human, rat

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

NM_139057

Q8TE56

dry ice

−20℃

human ... ADAMTS17(170691)

12 - Non Combustible Liquids

nwg

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)