Monoclonal Anti-CHST5, (C-terminal) antibody produced in mouse

NA.41

The carbohydrates of glycoconjugates are highly diverse structures with variation in monosaccharide composition, glycosidic linkage positions, and branching of chains. Further diversity is added by the covalent addition of sulfate moieties to particular hydroxyl groups and amino groups of saccharides. The sulfate modifications of glycoproteins can be extensive in amount and frequently occur at high density. They can have a profound effect on the physiochemical properties of the glycoconjugates, at least in part through the addition of negative charge. Carbohydrate sulfation plays a critical role in many biologic processes. CHST5 belongs to the GST family of sulfotransferases, which also includes CHST1 (MIM 603797), CHST2 (MIM 603798), CHST3 (MIM 603799), and LSST. These enzymes are 6-O-sulfotransferases, which add sulfate to C6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) (Lee et al., 1999 [PubMed 10491328]).[supplied by OMIM

CHST5 (NP_036258.1, 310 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSGIGKPIEAFHTSSRNARNVSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

2E6, monoclonal

buffered aqueous solution

antigen ~35.02 kDa

human

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG2bκ

NM_012126

Q9GZS9

dry ice

−20℃

human ... CHST5(23563)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1