Monoclonal Anti-FOXA2 antibody produced in mouse

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

7E6, monoclonal

buffered aqueous solution

human

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_021784

Q9Y261

dry ice

−20℃

human ... FOXA2(3170)

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Forkhead box A2 (FOXA2) expressed in the liver, pancreas, intestine, and lungs, is associated with embryonic formation of the primitive streak and endoderm. It also plays an important role in airway epithelial differentiation and is extensively expressed in type II pneumocytes. Decreased expression of Foxa2 is observed in lung cancer and non-small-cell lung cancer (NSCLC). FOXA2 plays a vital role in normal pancreatic β-cell function, therefore, aberration in the expression of the gene leads to hyperinsulinemic hypoglycemia. FOXA2 also has an essential role in pancreatic α-cell differentiation. FOXA2 expressed along with FOXA1 in the foregut endoderm plays a vital role in liver, hepatic and neuronal development, these factors also have an overlapping role in lung morphogenesis. FOXA2 acts a regulator of the network of gene associated with the intestinal epithelial cell function. Increased expression of FOXA2 in MKN-45 cells (human gastric cancer cell line) elevates E-cadherin expression and inhibits gastric cancer cell migration and invasion and therefore, FOXA2 is expressed at low levels in gastric adenocarcinoma tissues.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)