Monoclonal Anti-JTV1 antibody produced in mouse

NA.41

The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. (provided by RefSeq)

JTV1 (NP_006294.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT

Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 (AIMP2) is a scaffold protein which functions as a tumor suppressor. It stimulates the ubiquitin-mediated degradation of FUSE-binding protein (FUBP1), which is a transcription activator. AIMP2 activates tumor suppressor p53 and stimulates apoptosis. The assembly of macromolecular tRNA synthetase complex depends on AIMP2.

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

8E7, monoclonal

buffered aqueous solution

antigen 36.74 kDa

human

ELISA: suitable
western blot: 1-5 μg/mL

IgG2a

NM_006303

dry ice

−20℃

human ... JTV1(7965)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

13 - Non Combustible Solids

WGK 1