Monoclonal Anti-MAP3K4 antibody produced in mouse

MFCD08705590

NA.41

MAP3K4 (mitogen-activated protein kinase kinase kinase 4) gene encodes a component of protein kinase signal transduction cascade. It is also termed as MTK1 (MAP3 kinase 1). MAP3K4 contains a protein kinase catalytic domain at the C terminus and a regulatory/autoinhibitory domain at the N-terminus. It is located on human chromosome 6q26.
The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described. (provided by RefSeq)

MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS

MAP3K4 (mitogen-activated protein kinase kinase kinase 4) phosphorylates and activates a specific MAPK kinase (MAPKK) in the cascade through phosphorylation of conserved threonine and/or serine residues. GADD45 (growth arrest and DNA-damage-inducible proteins) proteins interact with and free the autoinhibitory domain from the kinase domain, thus activating MAP3K4. It mediates the activation of p38 MAPK pathway and the JNK (c-Jun N-terminal kinase) pathway induced by environmental stresses.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

6C6, monoclonal

buffered aqueous solution

mouse

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

NM_005922

O08648

dry ice

−20℃

human ... MAP3K4(4216)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)