Monoclonal Anti-MLL4 antibody produced in mouse

MFCD00675261

This gene encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known. (provided by RefSeq)

MLL4 (NP_055542, 813 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

4C10, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG1κ

NM_014727

dry ice

−20℃

human ... MLL4(9757)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)