Monoclonal Anti-PARK2 antibody produced in mouse

MFCD02263896

NA.41

The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. (provided by RefSeq)
The parkin RBR E3 ubiquitin protein ligase (PARK2) gene, with 12 exons spanning 1.35Mb on genomic DNA, is mapped to human chromosome 6q26. The gene codes for E3 ubiquitin-protein ligase parkin. The protein contains conserved ubiquitin-like domain (UBL) at N- terminal and four zinc coordinating domains, such as, RING0, RING1, in between ring (IBR) and RING2 domains at C-terminal.

PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

Parkin RBR E3 ubiquitin protein ligase (PARK2) catalyzes the monoubiquitination and polyubiquitination of proteins to regulate various cellular processes. The encoded protein plays a vital role in synaptic regulation. Genetic variations in the gene leads to autosomal recessive Parkinson′s disease (AR-PD) and sporadic PD.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1H4, monoclonal

buffered aqueous solution

human

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

IgG3κ

BC022014

dry ice

−20℃

human ... PARK2(5071)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)