Monoclonal Anti-PML antibody produced in mouse

MFCD06412254

NA.41

Promyelocytic leukemia (PML) is a 70 KDa protein, made of 560 amino acids.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.

PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV

Promyelocytic leukemia (PML) helps in the complete formation of the nuclear body. It can serve as a transcriptional cofactor. PML plays major roles in modulating cell morphology, proliferation and migration. It has the capability to block the ubiquitination and proteasomal degradation processes. Cytoplasmic PML is required to control TGF-β1 (transforming growth factor β 1) signaling.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

1D12, monoclonal

buffered aqueous solution

mouse, human, rat

indirect ELISA: suitable
indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

IgG2aκ

BC000080

P29590

dry ice

−20℃

human ... PML(5371)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)