Monoclonal Anti-YBX1 antibody produced in mouse

NA.41

Y-box binding protein 1 (YBX1) gene codes for Y-box protein 1 (YB-1) that has 324 amino acid residues, 8 exons and 7 introns. It is a member of the family of multifunctional DNA/RNA binding proteins. It is mainly present in the cytosol. YBX1 gene is mapped to human chromosome 1p34.

YBX1 (NP_004550, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA

Y-box binding protein 1 (YBX1) participates in pre-mRNA splicing, transcriptional regulation and mRNA translation and stability. It is also involved in DNA repair and environmental stress responses and chromatin remodeling.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

4F12, monoclonal

buffered aqueous solution

human

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

IgG2aκ

NM_004559

P67809

dry ice

−20℃

human ... YBX1(4904)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)