Anti-ALDH4A1 (AB1) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human ALDH4A1

Anti-ALDH4A1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Aldehyde dehydrogenase 4 family, member A1 (ALDH4A1; P5CD) is NAD-dependent dehydrogenase localized to the mitochondrial matrix. It catalyzes the formation of pyrroline-5-carboxylate to glutamate in the proline degradation pathway. Defects in ALDH4A1 gene results in the accumulation of proline associated with type II hyperprolinemia.

Synthetic peptide located within the following region: QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

24 kDa

horse, human, pig

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_003739

Q5TF55

wet ice

−20℃

human ... ALDH4A1(8659)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3