Anti-AMPH antibody produced in rabbit

MFCD01633026

NA.41

Synthetic peptide directed towards the N terminal region of human AMPH

Anti-AMPH antibody produced in rabbit is suitable for western blot.

AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.

Synthetic peptide located within the following region: ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

76 kDa

rabbit, horse, mouse, bovine, human, rat, dog, pig

0.5 mg - 1 mg/mL

western blot: suitable

P49418

wet ice

−20℃

human ... AMPH(273)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3