Anti-APG4B antibody produced in rabbit

MFCD09753846

NA.41

APG4B is a protease that processes autophagy-related proteins such as GATE-16, Apg8L MAP1-LC3, and GABARAP.
Rabbit Anti-APG4B antibody recognizes pig, zebrafish, chicken, bovine, human, mouse, rat, and canine APG4B.

Synthetic peptide directed towards the C terminal region of human APG4B

Rabbit Anti-APG4B antibody can be used for western blot (2.0 μg/ml) and IHC (4-8 μg/ml) applications.

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. APG4B encodes a member of the autophagin protein family and is also designated as a member of the C-54 family of cysteine proteases.

Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

44 kDa

guinea pig, rabbit, mouse, human, rat, dog, horse

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_037457

Q9Y4P1

wet ice

−20℃

human ... APG4B(23192)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3