Anti-CASP6 antibody produced in rabbit

MFCD01633093

HPA011337    Human Protein Atlas characterization data

CASP6 (caspase 6) belongs to the family of cysteine proteases called caspases. Caspases can be divided into inflammatory capases, apoptosis initiators and effector caspases, and CASP6 belongs to the effector class. It exists as a dimeric zymogen. Each CASP6 monomer contains a short pro-domain called CARD (caspase-recruitment domain) or DED (death effector domain), a large subunit (p20) and a small subunit (p10), intervened by an intersubunit linker (L). It is expressed in both fetal and adult human tissues, though it has a higher level of expression during development, and decreased levels in adult tissues. In fetus, CASP6 has the highest level of expression in the gastrointestinal tract and the lowest in brain. In adults, it is predominantly expressed in colon, lung, stomach, kidney and liver.

Caspase-6 precursor recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

CASP6 (caspase 6) plays a key role in apoptosis, and cleaves proteins which contain (V/I/T/L)E(G/D)ID sites. It has two classes of substrate proteins- proteins involved in nuclear structure or function and intermediate filament proteins. Lamin A, B and C, DNA topoisomerase I, CBP/p300, nuclear death domain protein p84N5, nuclear matrix protein SATB1, emerin, NuMA, DFF40, and PARP etc. act as its substrates in nucleus. Chromatin condensation in apoptosis is a result of proteolysis of lamin A by CASP6. In cytoplasm, it acts upon desmin, vimentin and cytokeratin, thereby modulating cell structure and function. It is responsible for the degradation of axons in the primary cortex. It enhances the synthesis of amyloid β peptide (Aβ), and is highly expressed in the hippocampus and cortex in the brains of Alzheimer′s disease (AD) patients. CASP6 is also involved in the impairment of cognitive abilities in AD patients.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70822.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

DVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQV

P55212

wet ice

−20℃

human ... CASP6(839)

12 - Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)