Anti-CATSPER2 (AB2) antibody produced in rabbit

NA.41

Synthetic peptide directed towards the N terminal region of human CATSPER2

Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Synthetic peptide located within the following region: HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

46 kDa

human, rabbit

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_473361

Q96P54

wet ice

−20℃

human ... CATSPER2(117155)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 3