Anti-CNIH antibody produced in rabbit

NA.41

CNIH (cornichon family AMPA receptor auxiliary protein) is located in the endoplasmic reticulum. T-cell growth associated molecule 77 (TGAM77), the human homolog of cornichon gene of the fruit fly Drosophila is expressed at high level in heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood lymphocytes (PBL) and bone marrow.

Synthetic peptide directed towards the N terminal of human CNIH

T-cell growth associated molecule 77 (TGAM77) may participate in a protein–tyrosine kinase pathway that is essential for the vectorial localization of signaling molecules in T-cell activation.

Synthetic peptide located within the following region: AFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPL

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

15 kDa

horse, rat, bovine, mouse, guinea pig, human, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_001106029

B0BNA6

wet ice

−20℃

human ... CNIH1(10175)
rat ... Cnih(289994)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3