Anti-CSRNP2 antibody produced in rabbit

HPA018503    Human Protein Atlas characterization data

The gene CSRNP2 (cysteine/serine-rich nuclear protein-2) is mapped to human chromosome 12q13.13. It belongs to CSRNP family. Northern blot analysis showed presence of CSRNP2 in various tissues, particularly in thymus, brain and ovary. Low transcripts levels of CSRNP2 are also detected in T cells. The protein is localized in the nucleus.

TGF-beta-induced apoptosis protein 12 (TAIP-12) (Protein FAM130A1)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The proteins from cysteine/serine-rich nuclear protein (CSRNP) family possess transcription factor properties. Single CSRNP2 knockdown in mice does not result in any abnormality, however, CSRNP2/3 double knockout results in a partial neonatal lethality. CSRNP2 is also isolated as one of the candidate genes for obesity.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST74170.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

recombinant expression
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS

wet ice

−20℃

human ... FAM130A1(81566)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)