Anti-CYP4F2 antibody produced in rabbit

HPA014048    Human Protein Atlas characterization data

The gene CYP4F2 (cytochrome P450 family 4 subfamily F member 2) encodes a protein belonging to the P450 superfamily of enzymes. The gene is mapped to human chromosome 19p13.12. It is expressed in human liver and renal microsomes. It is mostly localized to the S2 and S3 segments of the proximal tubule in kidney.

Cytochrome P450 4F2 recombinant protein epitope signature tag (PrEST)

Anti-CYP4F2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene CYP4F2 (cytochrome P450 family 4 subfamily F member 2) encodes a Vitamin K1 oxidase that catalyzes the hydroxylation of the tocopherol phytyl side chain in the inactivation pathway of vitamin E. It mediates the ω-hydroxylation of arachidonic acid to 20-HETE (20-Hydroxyeicosatetraenoic acid) in human liver. 20-HETE is involved in the control of kidney vascular and tubular function, vascular tone control in cerebral and coronary circulation, and in turn, blood pressure. Polymorphism in this gene is associated with altered requirement of warfarin dose used to treat thrombotic events. Aberration V433M (rs2108622) in this gene is linked to ischemic stroke in the Northern Chinese Han population.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72369.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20- 1:50

RRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPD

P78329

wet ice

−20℃

human ... CYP4F2(8529)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10;12 - Combustible liquids;Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)