Anti-DNTT antibody produced in rabbit

MFCD00164747

NA.41

Synthetic peptide directed towards the middle region of human DNTT

DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5′-triphosphate to the 3′-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells.This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3′-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

58 kDa

human, guinea pig, horse

0.5 mg - 1 mg/mL

western blot: suitable

NM_004088

P04053

wet ice

−20℃

human ... DNTT(1791)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3