Anti-FDFT1 antibody produced in rabbit

HPA008874    Human Protein Atlas characterization data

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) is also known as squalene synthase (SS), and is an essential enzyme of the cholesterol biogenesis pathway. This protein has a putative molecular weight of 48,041 and is composed of 417 amino acids. Two variants of FDFT1 mRNA are found in humans, which differ at their 3′ untranslated regions. They are of 2kb and 1.55kb and are equally expressed in heart, lung, liver, kidney, pancreas and placenta. However, the 2kb transcript is abundant in heart and skeletal muscle.

Squalene synthetase recombinant protein epitope signature tag (PrEST)

Anti-FDFT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) enzyme catalyzes the first committed reaction in steroid/hopanoid pathways. It catalyzes the conversion of two farnesyl diphosphates (FPPs) into squalene. It is also thought to be involved in carotenoid biosynthesis, where it might be responsible for the production of carotenoid dehydrosqualene. It determines the fate towards sterol synthesis. In prostate cancer cells, its expression is elevated by androgens, which are mevalonate/isoprenoid pathway intermediates which facilitate cholesterol synthesis. Thus, this enzyme might be implicated in cholesterol synthesis in cancer cells, and might be a therapeutic target for antineoplastic strategies. In chronic hepatitis C (CHC) patients, this protein is linked with advanced fibrosis in non-steatotic subgroup. Overexpression of FDFT1 results in elevated activation of tumor necrosis factor (TNF)-α receptor 1 and nuclear factor (NF)-κB pathways and increased expression of MMP (matrix metallopeptidase) 1, which in turn facilitates the metastasis of lung cancer.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST86797.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR

P37268

wet ice

−20℃

human ... FDFT1(2222)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)