Anti-KCNS3 antibody produced in rabbit

HPA014864    Human Protein Atlas characterization data

KCNS3 (potassium voltage-gated channel, modifier subfamily S, member 3) codes for the modulatory α-subunit of Kv9.3 votlage-gated potassium channel. This gene is found to be expressed in vascular tissues of human placenta and syncytiotrophoblast. It is localized to human chromosome 2, and has a wide range of tissue expression, with the highest being in brain and lungs.

Potassium voltage-gated channel subfamily S member 3 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

KCNS3 (potassium voltage-gated channel, modifier subfamily S, member) controls the tonicity and sensitivity of neural and muscle cells, by regulating their resting potential. It controls the membrane potential at sub-threshold levels. It is involved in the repetitive firing and high-frequency of parvalbumin neurons, by controlling the repolarization of action potential. In parvalbumin neurons, it is responsible for the exact recognition of co-incident excitatory synaptic inputs, which in turn affects γ-oscillations. In schizophrenia, KCNS3 expression is lowered in prefrontal cortical parvalbumin neurons, which might lead to defective cognitive processes. Variants in this gene are associated with airway hyperresponsiveness. It forms hetero-tetrameric channel with Kv2.1 α-subunits, and this channel contributes to the myogenic regulation of arterial diameter of the cerebrum.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST73064.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA

Q9BQ31

wet ice

−20℃

human ... KCNS3(3790)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)