Anti-LAMP3 antibody produced in mouse

NA.41

LAMP3 (AAH32940.1, 1 a.a. ~ 416 a.a) full-length human protein.

Sequence
MPRQLSAAAALFASLAVILHDGSQMRAKAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI

LAMP3 (lysosomal associated membrane protein 3) is tumor-specific protein and induced by hypoxia. It is known to be associated with tumors, inflammation and the maturation of dendritic cells. LAMP3 is found to be associated with Salmonella infection and promotes its intracellular proliferation. Upregulation of the gene is observed in a number of cancer such as cervical, breast, and gastrointestinal cancer and in lymph node metastasis. Increased expression of the gene shows resistance to chemotherapy and radiotherapy, and, LAMP3 might be responsible for tumor metastasis. In vitro studies point out that LAMP3 promotes invasion and migration of tumor cells.

Solution in phosphate buffered saline, pH 7.4

100

mouse

unconjugated

purified immunoglobulin

primary antibodies

polyclonal

buffered aqueous solution

human

western blot: 1 μg/mL

BC032940.2

Q9UQV4

dry ice

−20℃

human ... LAMP3(27074)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids