Anti-MARCH7 antibody produced in rabbit

HPA014275    Human Protein Atlas characterization data

membrane-associated ring finger (C3HC4) 7 recombinant protein epitope signature tag (PrEST)

Anti-MARCH7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene MARCH7 (membrane associated ring-CH-type finger 7) encodes a member of the MARCH family of seven membrane-associated E3 ubiquitin ligases. They contain a noncanonical RING domain called RING-CH-domain. The gene was first identified in mouse embryonic stem cells as a neural stem cell gene. The encoded protein is also referred to as Axotrophin. The gene is mapped to human chromosome 2. It has been found to be produced mainly in neural progenitor cells, intestinal crypt stem cells, megakaryocytes, trophoblasts, some lymphocytes and the splenic sinusoid, indicating a possible role in the development as well as the immune system. It has also been associated with the control of expression of the regulatory T-lymphocyte transcription factor Foxp3 and the suppressor of cytokine signalling 3 (SOCS3) gene.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72731.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

independent
Learn more about Antibody Enhanced Validation

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWNSADGKSDKTKSAPSRDPERLQKIK

wet ice

−20℃

human ... MARCH7(64844)

10 - Combustible liquids

WGK 1