Anti-MPP3 antibody produced in rabbit

HPA024742    Human Protein Atlas characterization data

The gene MPP3 (membrane palmitoylated protein 3) is mapped to human chromosome 17q21. The encoded protein belongs to the MAGUK (membrane associated guanylate kinase) family. The protein localizes in the cytoplasm and has a pair of Lin2/Lin7-binding (L27) domains, a PDZ (PSD95, Dlg1 and zo-1) domain, a Src-homology 3 (SH3) domain and a guanylate kinase homologous (GuK) domain.

MAGUK p55 subfamily member 3 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

MPP3 (membrane palmitoylated protein 3) is a scaffold protein. It forms a cell adhesion complex by associating with CADM1 (cell adhesion molecule 1) and 4.1B. It also interacts with the tumor suppressor protein TSLC1 (tumor suppressor in lung cancer 1). MPP3 is upregulated in hepatocellular carcinoma and is associated with cell migration, cell invasion and poorer survival of patients.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST75730.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

recombinant expression
Learn more about Antibody Enhanced Validation

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGL

Q13368

wet ice

−20℃

human ... MPP3(4356)

10 - Combustible liquids

WGK 1