Anti-PAX4 antibody produced in rabbit

NA.41

Rabbit polyclonal anti-PAX4 antibody reacts with canine, rabbit, human, mouse, and rat paired box gene 4 transcription factors.
Paired box (PAX) genes are tissue specific homeodomain transcription factors involved in fetal and early animal tissue and cell specification and processes such as limb regeneration. Paired box gene 4 (PAX4) participates in pancreatic islet development and the differentiation of insulin-producing β cells. PAX4) is indispensable for the establishment of the β-cell lineage during development and for mature β-cell expansion and survival.

Synthetic peptide directed towards the middle region of human PAX4

Rabbit polyclonal anti-PAX4 antibody is used to tag paired box gene 4 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of paired box gene 4 in the differentiation, expansion and survival of pancreatic insulin-producing β cells.
Rabbit Anti-PAX4 antibody can be used for western blot applications at a concentration of 0.5-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.

PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.

Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

37 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_006184

O43316

wet ice

−20℃

human ... PAX4(5078)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3