Anti-PHF16 antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human PHF16

This gene is part of a gene cluster on chromosome Xp11.23. PHF16 contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known.This gene is part of a gene cluster on chromosome Xp11.23. The encoded protein contains a zinc finger motif often found in transcriptional regulators, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein.

Synthetic peptide located within the following region: KSYCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFY

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

94 kDa

human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

Q92613

wet ice

−20℃

human ... PHF16(9767)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3