Anti-POGK antibody produced in rabbit

NA.41

Synthetic peptide directed towards the middle region of human POGK

The exact function of the protein encoded by this gene is not known. However, POGK contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human.The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human.

Synthetic peptide located within the following region: SSESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAES

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

69 kDa

rabbit, human

0.5 mg - 1 mg/mL

western blot: suitable

NM_017542

Q9P215

wet ice

−20℃

human ... POGK(57645)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3