Anti-SKIIP antibody produced in rabbit

NA.41

SKIIP (SNW1) belongs to the SNW gene family and codes for a co-activator that facilitates transcription. In vertebrate embryos, SNW1 is known to modulate spatial BMP functions, neural crest specifications and neural plate synthesis.
Rabbit Anti-SKIIP recognizes mouse, canine, human, bovine, and rat SKIIP.

Synthetic peptide directed towards the N terminal region of human SKIIP

Rabbit Anti-SKIIP can be used for western blot applications at a concentration of 1-5μg/ml. It can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

SKIIP (Nuclear Protein SkiP, nuclear receptor coactivator NCoA-62, ski-interacting protein) is a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also interact with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.

Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

61 kDa

bovine, mouse, horse, rabbit, rat, human, pig, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_036377

Q13573

wet ice

−20℃

human ... SKIIP(22938)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3