Anti-Snf8 antibody produced in rabbit

NA.41

SNF8 (EAP30 or VPS22) forms a part of the ESCRT-II complex that regulates the endocytosis of ubiquitinated proteins. EAP30 is known to facilitate the endosomal sorting of chemokine and growth factor receptors that are marked for lysosomal degradation. SNF8 is also a part of the ELL complex that is involved in RNA polymerase II-mediated transcriptional elongation.
Rabbit Anti-SNF8 antibody recognizes bovine, zebrafish, chicken, human, mouse, rat, and canine SNF8.

Synthetic peptide directed towards the N terminal region of human EAP30

Rabbit Anti-SNF8 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL′s inhibitory activity in vitro.SNF8, VPS25 (MIM 610907), and VPS36 (MIM 610903) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM].

Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

29 kDa

mouse, rabbit, horse, human, rat, guinea pig, bovine, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_009172

Q96H20

wet ice

−20℃

human ... SNF8(11267)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3