Anti-SRCIN1 antibody produced in rabbit

HPA009701    Human Protein Atlas characterization data

SRCIN1 (SRC kinase signaling inhibitor 1) is a docking/adaptor protein, which is commonly known as p140Cap (CAS-associated protein). It is exclusively expressed in epithelial cells, brain and testis. It consists of a tyrosine rich domain, two proline-rich regions, a coil-coiled domain, two charged amino acid-rich domains, and a potential actin binding region. It was initially recognized as a synaptic membrane protein SNAP-25-binding partner.

p130Cas-associated protein recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

SRCIN1 (SRC kinase signaling inhibitor 1) is involved in synapse formation and maintenance in neurons, and in epithelial tumors, controls carcinoma cell characteristics mediated by integrin and growth factor. It interacts with the microtubule plus-end tracking protein EB3. This protein is absent in normal breast tissue, and its mRNA expression acts as a marker for poor prognosis in breast cancer. It is a direct target of miR-374a, and it repeals the oncogenic effects of miR-374a. miR-374a silences SRCIN1 in gastric cancer (GC), which results in elevated cell proliferation, migration and invasion. Its expression is also inhibited by miR-150 in lung cancer, which leads to enhanced cell proliferation and migration. SRCIN1 functions as a downstream effector of endophilin A1 and a disruption in their interaction results in abnormal spine morphogenesis and maturation.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72468.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20- 1:50

NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR

wet ice

−20℃

human ... SNIP(80725)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)