Anti-SYPL1 antibody produced in rabbit

HPA014141    Human Protein Atlas characterization data

The gene SYPL1 (synaptophysin-like 1) encodes a member of the physin protein family. The encoded protein is also called as pantophysin. The gene is mapped to human chromosome 7q22.3. It is found in non-neuronal tissues, but is related to the neuroendocrine-specific synaptophysin. It is predominantly found in adipose tissue and is mainly localized to membrane fractions. The encoded murine protein has a molar mass of 28,926Da and is similar to synaptophysin to a large extent.

Synaptophysin-like protein 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

The gene SYPL1 (synaptophysin-like 1) encodes a synaptic vesicle membrane protein that may function in the regulation of vesicle transport in adipocytes. It may serve as a marker for the analysis of other vesicles in adipocytes. SYPL1 is found to be co-localized with secretory carrier membrane proteins and the v-SNARE cellubrevin. It may be associated with small cytoplasmic transport vesicles and may participate in vesicle trafficking and fusion events. It is found to interact with GLUT4 (glucose transporter type 4, insulin-responsive)-containing vesicles and may function in trafficking of GLUT4.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST72548.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:50-1:200

ATGHNIIDELPPCKKKAVLCYFGSVTSMGS

Q16563

wet ice

−20℃

human ... SYPL1(6856)

10;12 - Combustible liquids;Non Combustible Liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)