Anti-TNFSF12 antibody produced in rabbit

NA.41

Tumor necrosis factor (ligand) superfamily, member 12/ TNF-like weak inducer of apoptosis (TNFSF12, APO3L, DR3LG, TWEAK), a tumor necrosis factor (TNF) ligand family cytokine, is a pleiotropic cytokine that mediates its cell signaling effect via binding to the FN14/TWEAK receptor (TWEAKR). TNFSF12/TWEAK, which is expressed in many tissue types, is an inflammatory cytokine that induces chemokines and other proinflammatory cytokines. TNFSF12/TWEAK regulates progenitor cell proliferation, differentiation, and survival in multiple organ systems.
Rabbit polyclonal anti-TNFSF12 antibody reacts with human, mouse, and canine tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis cytokines.

Synthetic peptide directed towards the N terminal region of human TNFSF12

Rabbit polyclonal anti-TNFSF12 antibody is used to tag tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of tumor necrosis factor (ligand) superfamily, member 12/TNF-like weak inducer of apoptosis in the regulation of progenitor cell proliferation, differentiation, and survival through FN14/TWEAK receptor cell signaling pathways. Anti-TNFSF12 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

27 kDa

human

0.5 mg - 1 mg/mL

western blot: suitable

NP_742086

O43508

wet ice

−20℃

human ... TNFSF12(8742)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3