Anti-TNK1 antibody produced in rabbit

HPA012065    Human Protein Atlas characterization data

TNK1 (Tyrosine kinase, non-receptor, 1) is a novel 72kDa nonreceptor tyrosine kinase protein beloniging to the ACK (Activated CDC42 kinase) family of non-receptor tyrosine kinases. It consists of an N-terminal kinase domain, a putative Src Homology 3 (SH3) domain at the C-terminal end, and a proline-rich tail. TNK1 is expressed in all fetal tissues such as cord blood, bone marrow and adult tissues such as prostate, testis, ovary, small intestine and colon. In addition to normal tissues, its expression also have been found in the several leukemia cell lines.

Non-receptor tyrosine-protein kinase TNK1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

TNK1 (Tyrosine kinase, non-receptor, 1) is majorly involved in the phospholipid signaling pathways. In addition to the kinase activity, it also negetively regulates Ras-Raf1-MAPK pathway. Studies have been suggested that TNK1 may possess tumor suppressor like properties as well as capacity of tumor necrosis factor-α-induced apoptosis. It may participate in various signaling pathways during fetal development and growth.

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71457.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:20- 1:50

PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG

Q13470

wet ice

−20℃

human ... TNK1(8711)

10 - Combustible liquids

WGK 1