Anti-TP53INP1 antibody produced in rabbit

HPA005856    Human Protein Atlas characterization data

tumor protein p53 inducible nuclear protein 1 recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Tumor protein p⁵³-inducible nuclear protein 1 is a protein encoded by the TP53INP1 gene in humans and is mapped to chromosome 8q22. It is referred as SIP, Teap, p53DINP1, TP53DINP1, TP53INP1A and TP53INP1B. It is a pro-apoptotic protein involved in cell stress response. Over-expression of this gene in numerous tissues leads to stress agents while down-expression is observed in stomach, pancreatic and inflammation-mediated colic carcinomas. Over-expression induces G1 cell cycle arrest and increases p53-mediated apoptosis. It may help in regulating p⁵³-dependent apoptosis through phosphorylation of p⁵³ at Ser46, serving as a cofactor for the putative p⁵³-Ser46 kinase. It may play a significant role in the progression of anaplastic carcinoma. This gene may be considered as a relevant-specific target for molecular therapy of castration-resistant prostate cancer (CRPC).

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70321.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies^® Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPC

Q96A56

wet ice

−20℃

human ... TP53INP1(94241)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1