Anti-TSEN15 antibody produced in rabbit

NA.41

The immunogen for anti-TSEN15 antibody: synthetic peptide derected towards the C terminal of human TSEN15

Tsen15 is a non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5′ and 3′ splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2′,3′ cyclic phosphate and 5′-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3′ end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3′ end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events.

Synthetic peptide located within the following region: ASLSHNRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFML

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

18 kDa

pig, human, mouse, rat, bovine, dog

0.5 mg - 1 mg/mL

western blot: suitable

NM_025677

Q8R3W5

wet ice

−20℃

human ... TSEN15(116461)
mouse ... Tsen15(66637)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3