Anti-CXCR4 (N-terminal) antibody produced in rabbit

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

40 kDa

mouse, pig, human, horse, rabbit

0.5 mg/mL

immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
western blot: 1 μg/mL

NM_003467

wet ice

−20℃

human ... CXCR4(57396)

CXCR4 is a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Synthetic peptide directed towards the N terminal region of human CXCR4

Synthetic peptide located within the following region: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

nwg