Anti-NR1I3 (AB4) antibody produced in rabbit

MFCD00802755

NA.41

Synthetic peptide directed towards the N terminal region of human NR1I3

Anti-NR1I3 (AB4) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Nuclear receptor subfamily 1, group I, member 3 (NR1I3), also known as constitutive androstane receptor (CAR; CAR1) is a nuclear receptor that acts with retinoid X receptor to regulate xenobiotic and endobiotic metabolism. The ligands for this receptor include steroid hormones, drugs and bilirubin. On binding the ligands, NR1l3 translocates to the nucleus and regulates the transcription of genes involved in drug metabolism, energy homeostasis and cancer development.

Synthetic peptide located within the following region: MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

39 kDa

pig, human

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_001070937

Q5VTW5

wet ice

−20℃

human ... NR1I3(9970)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3