SILu^TMLite TIMP1, Metalloproteinase inhibitor 1 human

NA.12

SILu^™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu^™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.

CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Supplied as a lyophilized powder containing phosphate buffered saline.

SILu is a trademark of sigma-aldrich Co. LLC

expressed in HEK 293 cells

200

≥98% (SDS-PAGE)

lyophilized powder

suitable for mass spectrometry (internal calibrator)

P01033

−20℃

11 - Combustible Solids

WGK 2